Lineage for d1q1ra3 (1q1r A:320-422)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 507534Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 507535Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
    both first two domains are of same beta/beta/alpha fold
  5. 507536Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (10 proteins)
  6. 507630Protein Putidaredoxin reductase [103115] (1 species)
  7. 507631Species Pseudomonas putida [TaxId:303] [103116] (2 PDB entries)
  8. 507632Domain d1q1ra3: 1q1r A:320-422 [95602]
    Other proteins in same PDB: d1q1ra1, d1q1ra2, d1q1rb1, d1q1rb2

Details for d1q1ra3

PDB Entry: 1q1r (more details), 1.91 Å

PDB Description: Crystal Structure of Putidaredoxin Reductase from Pseudomonas putida

SCOP Domain Sequences for d1q1ra3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q1ra3 d.87.1.1 (A:320-422) Putidaredoxin reductase {Pseudomonas putida}
vprdeaapwfwsdqyeiglkmvglsegydriivrgslaqpdfsvfylqgdrvlavdtvnr
pvefnqskqiitdrlpvepnllgdesvplkeiiaaakaelssa

SCOP Domain Coordinates for d1q1ra3:

Click to download the PDB-style file with coordinates for d1q1ra3.
(The format of our PDB-style files is described here.)

Timeline for d1q1ra3: