SCOPe 2.06: Domain d1q1oa1: 1q1o A:761-854

Lineage for d1q1oa1 (1q1o A:761-854)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.2: CAD & PB1 domains [54277] (3 families)
   contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily

5. Family d.15.2.2: PB1 domain [64225] (11 proteins)
   Pfam PF00564
   forms heterodimers, although not all PB1 domain pairs associate.

6. Protein Cell division control protein 24, CDC24, C-terminal domain [89834] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89835] (3 PDB entries)

8. Domain d1q1oa1: 1q1o A:761-854 [95596]
   Other proteins in same PDB: d1q1oa2

Details for d1q1oa1

PDB Entry: 1q1o

PDB Description: solution structure of the pb1 domain of cdc24p (long form)

PDB Compounds: (A:) Cell division control protein 24

SCOPe Domain Sequences for d1q1oa1:

Sequence; same for both SEQRES and ATOM records:

>d1q1oa1 d.15.2.2 (A:761-854) Cell division control protein 24, CDC24, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
silfrisynnnsnntssseiftllvekvwnfddlimainskisnthnnnispitkikyqd
edgdfvvlgsdedwnvakemlaennekflnirly

Timeline for d1q1oa1:

• d1q1oa1 first appeared in SCOP 1.67, called d1q1oa_
  
• d1q1oa1 was called d1q1oa_ in SCOPe 2.05
  
• d1q1oa1 appears in SCOPe 2.07
  
• d1q1oa1 appears in the current release, SCOPe 2.08