Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.2: CAD & PB1 domains [54277] (3 families) contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily |
Family d.15.2.2: PB1 domain [64225] (11 proteins) Pfam PF00564 forms heterodimers, although not all PB1 domain pairs associate. |
Protein Cell division control protein 24, CDC24, C-terminal domain [89834] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89835] (3 PDB entries) |
Domain d1q1oa1: 1q1o A:761-854 [95596] Other proteins in same PDB: d1q1oa2 |
PDB Entry: 1q1o (more details)
SCOPe Domain Sequences for d1q1oa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q1oa1 d.15.2.2 (A:761-854) Cell division control protein 24, CDC24, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} silfrisynnnsnntssseiftllvekvwnfddlimainskisnthnnnispitkikyqd edgdfvvlgsdedwnvakemlaennekflnirly
Timeline for d1q1oa1: