SCOP 1.69: Domain d1q1oa_: 1q1o A:

Lineage for d1q1oa_ (1q1o A:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.2: CAD & PB1 domains [54277] (2 families)
   contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily

5. Family d.15.2.2: PB1 domain [64225] (5 proteins)
   Pfam 00564
   forms heterodimers, although not all PB1 domain pairs associate.

6. Protein Cell division control protein 24, CDC24, C-terminal domain [89834] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89835] (2 PDB entries)

8. Domain d1q1oa_: 1q1o A: [95596]

Details for d1q1oa_

PDB Entry: 1q1o

PDB Description: solution structure of the pb1 domain of cdc24p (long form)

SCOP Domain Sequences for d1q1oa_:

Sequence; same for both SEQRES and ATOM records:

>d1q1oa_ d.15.2.2 (A:) Cell division control protein 24, CDC24, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
gplgsilfrisynnnsnntssseiftllvekvwnfddlimainskisnthnnnispitki
kyqdedgdfvvlgsdedwnvakemlaennekflnirly

Timeline for d1q1oa_:

• d1q1oa_ first appeared in SCOP 1.67
  
• d1q1oa_ appears in SCOP 1.71
  
• d1q1oa_ appears in the current release, SCOPe 2.08, called d1q1oa1