Lineage for d1q1ka2 (1q1k A:225-299)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1651257Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 1651469Family d.58.5.3: ATP phosphoribosyltransferase (ATP-PRTase, HisG), regulatory C-terminal domain [88851] (1 protein)
    automatically mapped to Pfam PF08029
  6. 1651470Protein ATP phosphoribosyltransferase (ATP-PRTase, HisG), regulatory C-terminal domain [82669] (2 species)
    binds allosteric inhibitor histidine
  7. 1651471Species Escherichia coli [TaxId:562] [102977] (2 PDB entries)
  8. 1651473Domain d1q1ka2: 1q1k A:225-299 [95590]
    Other proteins in same PDB: d1q1ka1
    complexed with prt, tla

Details for d1q1ka2

PDB Entry: 1q1k (more details), 2.9 Å

PDB Description: structure of atp-phosphoribosyltransferase from e. coli complexed with pr-atp
PDB Compounds: (A:) ATP phosphoribosyltransferase

SCOPe Domain Sequences for d1q1ka2:

Sequence, based on SEQRES records: (download)

>d1q1ka2 d.58.5.3 (A:225-299) ATP phosphoribosyltransferase (ATP-PRTase, HisG), regulatory C-terminal domain {Escherichia coli [TaxId: 562]}
eskyimmhapterldeviallpgaerptilplagdqqrvamhmvssetlfwetmeklkal
gassilvlpiekmme

Sequence, based on observed residues (ATOM records): (download)

>d1q1ka2 d.58.5.3 (A:225-299) ATP phosphoribosyltransferase (ATP-PRTase, HisG), regulatory C-terminal domain {Escherichia coli [TaxId: 562]}
eskyimmhapterldeviallpgaerptilplamhmvssetlfwetmeklkalgassilv
lpiekmme

SCOPe Domain Coordinates for d1q1ka2:

Click to download the PDB-style file with coordinates for d1q1ka2.
(The format of our PDB-style files is described here.)

Timeline for d1q1ka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1q1ka1