Lineage for d1q1jl2 (1q1j L:109-213)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 366115Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)
  7. 366119Species Human (Homo sapiens) [TaxId:9606] [88572] (42 PDB entries)
  8. 366153Domain d1q1jl2: 1q1j L:109-213 [95586]
    Other proteins in same PDB: d1q1jh1, d1q1jh2, d1q1ji1, d1q1ji2, d1q1jl1, d1q1jm1

Details for d1q1jl2

PDB Entry: 1q1j (more details), 2.5 Å

PDB Description: Crystal Structure Analysis of anti-HIV-1 Fab 447-52D in complex with V3 peptide

SCOP Domain Sequences for d1q1jl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q1jl2 b.1.1.2 (L:109-213) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens)}
pkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqs
nnkyaassylsltpeqwkshrsyscqvthegstvektvapte

SCOP Domain Coordinates for d1q1jl2:

Click to download the PDB-style file with coordinates for d1q1jl2.
(The format of our PDB-style files is described here.)

Timeline for d1q1jl2: