Lineage for d1q1ji2 (1q1j I:114-227)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 365019Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 365023Species Human (Homo sapiens) [TaxId:9606] [88575] (78 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 365085Domain d1q1ji2: 1q1j I:114-227 [95584]
    Other proteins in same PDB: d1q1jh1, d1q1ji1, d1q1jl1, d1q1jl2, d1q1jm1, d1q1jm2
    part of anti HIV-1 Fab 447-52d

Details for d1q1ji2

PDB Entry: 1q1j (more details), 2.5 Å

PDB Description: Crystal Structure Analysis of anti-HIV-1 Fab 447-52D in complex with V3 peptide
PDB Compounds: (I:)

SCOP Domain Sequences for d1q1ji2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q1ji2 b.1.1.2 (I:114-227) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
astkgpsvfplapcsrstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtytcnvnhkpsntkvdkrvel

SCOP Domain Coordinates for d1q1ji2:

Click to download the PDB-style file with coordinates for d1q1ji2.
(The format of our PDB-style files is described here.)

Timeline for d1q1ji2: