Lineage for d1q1ha_ (1q1h A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982196Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1983278Family a.4.5.41: Transcription factor E/IIe-alpha, N-terminal domain [101024] (1 protein)
    contains extra N-terminal helix
    automatically mapped to Pfam PF02002
  6. 1983279Protein Transcription factor E/IIe-alpha, N-terminal domain [101025] (1 species)
  7. 1983280Species Sulfolobus solfataricus [TaxId:2287] [101026] (1 PDB entry)
  8. 1983281Domain d1q1ha_: 1q1h A: [95580]
    protein/RNA complex

Details for d1q1ha_

PDB Entry: 1q1h (more details), 2.9 Å

PDB Description: An extended winged helix domain in general transcription factor E/IIE alpha
PDB Compounds: (A:) Transcription Factor E

SCOPe Domain Sequences for d1q1ha_:

Sequence, based on SEQRES records: (download)

>d1q1ha_ a.4.5.41 (A:) Transcription factor E/IIe-alpha, N-terminal domain {Sulfolobus solfataricus [TaxId: 2287]}
mvnaedlfinlaksllgddvidvlrilldkgtemtdeeianqlnikvndvrkklnlleeq
gfvsyrktrdkdsgwfiyywkpnidqin

Sequence, based on observed residues (ATOM records): (download)

>d1q1ha_ a.4.5.41 (A:) Transcription factor E/IIe-alpha, N-terminal domain {Sulfolobus solfataricus [TaxId: 2287]}
mvnaedlfinlaksllgddvidvlrilldkgtemtdeeianqlnikvndvrkklnlleeq
gfvsyrktrsgwfiyywkpnidqin

SCOPe Domain Coordinates for d1q1ha_:

Click to download the PDB-style file with coordinates for d1q1ha_.
(The format of our PDB-style files is described here.)

Timeline for d1q1ha_: