SCOPe 2.05: Domain d1q1gd_: 1q1g D:

Lineage for d1q1gd_ (1q1g D:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)

6. Protein Putative uridine phosphorylase [102500] (1 species)

7. Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [102501] (3 PDB entries)

8. Domain d1q1gd_: 1q1g D: [95577]
   complexed with ipa, mti, so4

Details for d1q1gd_

PDB Entry: 1q1g, 2.02 Å

PDB Description: Crystal structure of Plasmodium falciparum PNP with 5'-methylthio-immucillin-H

PDB Compounds: (D:) Uridine phosphorylase putative

SCOPe Domain Sequences for d1q1gd_:

Sequence; same for both SEQRES and ATOM records:

>d1q1gd_ c.56.2.1 (D:) Putative uridine phosphorylase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
nllrhlkiskeqitpvvlvvgdpgrvdkikvvcdsyvdlaynreyksvechykgqkflcv
shgvgsagcavcfeelcqngakviiragscgslqpdlikrgdicicnaavredrvshlli
hgdfpavgdfdvydtlnkcaqelnvpvfngisvssdmyypnkiipsrledyskanaavve
melatlmvigtlrkvktggilivdgcpfkwdegdfdnnlvphqlenmikialgacaklat
kya

Timeline for d1q1gd_:

• d1q1gd_ first appeared in SCOP 1.67
  
• d1q1gd_ appears in SCOPe 2.04
  
• d1q1gd_ appears in SCOPe 2.06
  
• d1q1gd_ appears in the current release, SCOPe 2.08