SCOP 1.67: Domain d1q1gc_: 1q1g C:

Lineage for d1q1gc_ (1q1g C:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (5 proteins)

6. Protein Putative uridine phosphorylase [102500] (1 species)

7. Species Plasmodium falciparum [102501] (3 PDB entries)

8. Domain d1q1gc_: 1q1g C: [95576]

Details for d1q1gc_

PDB Entry: 1q1g, 2.02 Å

PDB Description: Crystal structure of Plasmodium falciparum PNP with 5'-methylthio-immucillin-H

SCOP Domain Sequences for d1q1gc_:

Sequence; same for both SEQRES and ATOM records:

>d1q1gc_ c.56.2.1 (C:) Putative uridine phosphorylase {Plasmodium falciparum}
nllrhlkiskeqitpvvlvvgdpgrvdkikvvcdsyvdlaynreyksvechykgqkflcv
shgvgsagcavcfeelcqngakviiragscgslqpdlikrgdicicnaavredrvshlli
hgdfpavgdfdvydtlnkcaqelnvpvfngisvssdmyypnkiipsrledyskanaavve
melatlmvigtlrkvktggilivdgcpfkwdegdfdnnlvphqlenmikialgacaklat
kya

Timeline for d1q1gc_:

• d1q1gc_ is new in SCOP 1.67
  
• d1q1gc_ appears in SCOP 1.69
  
• d1q1gc_ appears in the current release, SCOPe 2.08