SCOPe 2.06: Domain d1q1ea1: 1q1e A:236-370

Lineage for d1q1ea1 (1q1e A:236-370)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.6: MOP-like [50331] (4 families)

5. Family b.40.6.3: ABC-transporter additional domain [50338] (4 proteins)
   probably stems out from the biMOP domain

6. Protein Maltose transport protein MalK, C-terminal domain [63406] (2 species)

7. Species Escherichia coli [TaxId:562] [101772] (15 PDB entries)

8. Domain d1q1ea1: 1q1e A:236-370 [95570]
   Other proteins in same PDB: d1q1ea2, d1q1eb2

Details for d1q1ea1

PDB Entry: 1q1e, 2.9 Å

PDB Description: The ATPase component of E. coli maltose transporter (MalK) in the nucleotide-free form

PDB Compounds: (A:) Maltose/maltodextrin transport ATP-binding protein malK

SCOPe Domain Sequences for d1q1ea1:

Sequence; same for both SEQRES and ATOM records:

>d1q1ea1 b.40.6.3 (A:236-370) Maltose transport protein MalK, C-terminal domain {Escherichia coli [TaxId: 562]}
spkmnflpvkvtataidqvqvelpmpnrqqvwlpvesrdvqvganmslgirpehllpsdi
advilegevqvveqlgnetqihiqipsirqnlvyrqndvvlveegatfaiglpperchlf
redgtacrrlhkepg

Timeline for d1q1ea1:

• d1q1ea1 first appeared in SCOP 1.67
  
• d1q1ea1 appears in SCOPe 2.05
  
• d1q1ea1 appears in SCOPe 2.07
  
• d1q1ea1 appears in the current release, SCOPe 2.08