Lineage for d1q1bd1 (1q1b D:236-370)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 949212Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 951219Superfamily b.40.6: MOP-like [50331] (3 families) (S)
  5. 951303Family b.40.6.3: ABC-transporter additional domain [50338] (4 proteins)
    probably stems out from the biMOP domain
  6. 951323Protein Maltose transport protein MalK, C-terminal domain [63406] (2 species)
  7. 951324Species Escherichia coli [TaxId:562] [101772] (6 PDB entries)
  8. 951344Domain d1q1bd1: 1q1b D:236-370 [95568]
    Other proteins in same PDB: d1q1ba2, d1q1bb2, d1q1bc2, d1q1bd2

Details for d1q1bd1

PDB Entry: 1q1b (more details), 2.8 Å

PDB Description: Crystal structure of E. coli MalK in the nucleotide-free form
PDB Compounds: (D:) Maltose/maltodextrin transport ATP-binding protein malK

SCOPe Domain Sequences for d1q1bd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q1bd1 b.40.6.3 (D:236-370) Maltose transport protein MalK, C-terminal domain {Escherichia coli [TaxId: 562]}
spkmnflpvkvtataidqvqvelpmpnrqqvwlpvesrdvqvganmslgirpehllpsdi
advilegevqvveqlgnetqihiqipsirqnlvyrqndvvlveegatfaiglpperchlf
redgtacrrlhkepg

SCOPe Domain Coordinates for d1q1bd1:

Click to download the PDB-style file with coordinates for d1q1bd1.
(The format of our PDB-style files is described here.)

Timeline for d1q1bd1: