SCOP 1.69: Domain d1q19d1: 1q19 D:206-501

Lineage for d1q19d1 (1q19 D:206-501)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (5 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.1: N-type ATP pyrophosphatases [52403] (6 proteins)

6. Protein beta-Lactam synthetase [69456] (2 species)
   Asparagine synthetase B homologue

7. Species Pectobacterium carotovorum [TaxId:554] [102263] (2 PDB entries)
   carbapenam synthetase CarA

8. Domain d1q19d1: 1q19 D:206-501 [95559]
   Other proteins in same PDB: d1q19a2, d1q19b2, d1q19c2, d1q19d2

Details for d1q19d1

PDB Entry: 1q19, 2.4 Å

PDB Description: Carbapenam Synthetase

SCOP Domain Sequences for d1q19d1:

Sequence; same for both SEQRES and ATOM records:

>d1q19d1 c.26.2.1 (D:206-501) beta-Lactam synthetase {Pectobacterium carotovorum}
pasnqllalprepllalidrylnapledlaprfdtvgiplsggldsslvtalasrhfkkl
ntysigtelsnefefsqqvadalgthhqmkilsetevingiiesiyyneifdglsaeiqs
glfnvyrqaqgqvscmltgygsdllfggilkpgaqydnpnqllaeqvyrtrwtgefathg
ascygidirhpfwshslislchalhpdykifdnevknilreyadslqllpkdivwrkkig
ihegssvnqafanvlgstvdnyqtksrftyrvyqaflrgrlsitdvtpsqlkdlik

Timeline for d1q19d1:

• d1q19d1 first appeared in SCOP 1.67
  
• d1q19d1 appears in SCOP 1.71
  
• d1q19d1 appears in the current release, SCOPe 2.08