![]() | Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
![]() | Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
![]() | Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) ![]() N-terminal residue provides two catalytic groups, nucleophile and proton donor |
![]() | Family d.153.1.1: Class II glutamine amidotransferases [56236] (6 proteins) has slightly different topology than other families do |
![]() | Protein beta-Lactam synthetase [69831] (2 species) Asparagine synthetase B homologue |
![]() | Species Pectobacterium carotovorum [TaxId:554] [103312] (2 PDB entries) carbapenam synthetase CarA |
![]() | Domain d1q19c2: 1q19 C:2-205 [95558] Other proteins in same PDB: d1q19a1, d1q19b1, d1q19c1, d1q19d1 |
PDB Entry: 1q19 (more details), 2.4 Å
SCOP Domain Sequences for d1q19c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q19c2 d.153.1.1 (C:2-205) beta-Lactam synthetase {Pectobacterium carotovorum} snsfcvvykgsdtdinniqrdfdgkgealsngylfieqnghyqkcemergtayligslyn rtfliglagvwegeaylandaellallftrlganalalaegdfcffidepngeltvites rgfspvhvvqgkkawmtnslklvtaaegegalwfeeealvcqslmradtytpvknaqrlk pgavhvlthdsegysfvesrtltt
Timeline for d1q19c2: