Lineage for d1q19a2 (1q19 A:2-205)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 512789Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 512790Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 512791Family d.153.1.1: Class II glutamine amidotransferases [56236] (6 proteins)
    has slightly different topology than other families do
  6. 512810Protein beta-Lactam synthetase [69831] (2 species)
    Asparagine synthetase B homologue
  7. 512811Species Pectobacterium carotovorum [TaxId:554] [103312] (2 PDB entries)
    carbapenam synthetase CarA
  8. 512816Domain d1q19a2: 1q19 A:2-205 [95554]
    Other proteins in same PDB: d1q19a1, d1q19b1, d1q19c1, d1q19d1

Details for d1q19a2

PDB Entry: 1q19 (more details), 2.4 Å

PDB Description: Carbapenam Synthetase

SCOP Domain Sequences for d1q19a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q19a2 d.153.1.1 (A:2-205) beta-Lactam synthetase {Pectobacterium carotovorum}
snsfcvvykgsdtdinniqrdfdgkgealsngylfieqnghyqkcemergtayligslyn
rtfliglagvwegeaylandaellallftrlganalalaegdfcffidepngeltvites
rgfspvhvvqgkkawmtnslklvtaaegegalwfeeealvcqslmradtytpvknaqrlk
pgavhvlthdsegysfvesrtltt

SCOP Domain Coordinates for d1q19a2:

Click to download the PDB-style file with coordinates for d1q19a2.
(The format of our PDB-style files is described here.)

Timeline for d1q19a2: