Lineage for d1q17b_ (1q17 B:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 694236Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 694237Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (6 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 694413Family c.31.1.5: Sir2 family of transcriptional regulators [63984] (7 proteins)
    silent information regulator 2; contains insertion of a rubredoxin-like zinc finger domain
  6. 694437Protein Hst2 [102294] (1 species)
  7. 694438Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [102295] (5 PDB entries)
  8. 694444Domain d1q17b_: 1q17 B: [95551]

Details for d1q17b_

PDB Entry: 1q17 (more details), 2.7 Å

PDB Description: Structure of the yeast Hst2 protein deacetylase in ternary complex with 2'-O-acetyl ADP ribose and histone peptide
PDB Compounds: (B:) HST2 protein

SCOP Domain Sequences for d1q17b_:

Sequence, based on SEQRES records: (download)

>d1q17b_ c.31.1.5 (B:) Hst2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
hhgmasmsvstastemsvrkiaahmksnpnakvifmvgagistscgipdfrspgtglyhn
larlklpypeavfdvdffqsdplpfytlakelypgnfrpskfhyllklfqdkdvlkrvyt
qnidtlerqagvkddliieahgsfahchcigcgkvyppqvfksklaehpikdfvkcdvcg
elvkpaivffgedlpdsfsetwlndsewlrekittsgkhpqqplvivvgtslavypfasl
peeiprkvkrvlcnletvgdfkankrptdlivhqysdefaeqlveelgwqedfekiltaq

Sequence, based on observed residues (ATOM records): (download)

>d1q17b_ c.31.1.5 (B:) Hst2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
hhgmasmsvstastemsvrkiaahmksnpnakvifmvgagistscgipdfrspgtglyhn
larlklpypeavfdvdffqsdplpfytlakelypgnfrpskfhyllklfqdkdvlkrvyt
qnidtlerqagvkddliieahgsfahchcigcgkvyppqvfksklaehpikdfvkcdvcg
elvkpaivffgedlpdsfsetwlndsewlrekipqqplvivvgtslavypfaslpeeipr
kvkrvlcnletvgdfkankrptdlivhqysdefaeqlveelgwqedfekiltaq

SCOP Domain Coordinates for d1q17b_:

Click to download the PDB-style file with coordinates for d1q17b_.
(The format of our PDB-style files is described here.)

Timeline for d1q17b_: