Lineage for d1q16b_ (1q16 B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2555939Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2556102Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
  6. 2556250Protein Respiratory nitrate reductase 1 beta chain [102955] (2 species)
  7. 2556255Species Escherichia coli [TaxId:562] [102956] (8 PDB entries)
    Uniprot P11349
  8. 2556257Domain d1q16b_: 1q16 B: [95548]
    Other proteins in same PDB: d1q16a1, d1q16a2, d1q16c_
    complexed with 3ph, 6mo, aga, f3s, hem, md1, sf4

Details for d1q16b_

PDB Entry: 1q16 (more details), 1.9 Å

PDB Description: Crystal structure of Nitrate Reductase A, NarGHI, from Escherichia coli
PDB Compounds: (B:) Respiratory nitrate reductase 1 beta chain

SCOPe Domain Sequences for d1q16b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q16b_ d.58.1.5 (B:) Respiratory nitrate reductase 1 beta chain {Escherichia coli [TaxId: 562]}
mkirsqvgmvlnldkcigchtcsvtcknvwtsregveyawfnnvetkpgqgfptdwenqe
kykggwirkingklqprmgnramllgkifanphlpgiddyyepfdfdyqnlhtapegsks
qpiarprslitgermakiekgpnweddlggefdklakdknfdniqkamysqfentfmmyl
prlcehclnpacvatcpsgaiykreedgivlidqdkcrgwrmcitgcpykkiyfnwksgk
sekcifcyprieagqptvcsetcvgrirylgvllydadaieraastenekdlyqrqldvf
ldpndpkvieqaikdgiplsvieaaqqspvykmamewklalplhpeyrtlpmvwyvppls
piqsaadagelgsngilpdveslripvqylanlltagdtkpvlralkrmlamrhykraet
vdgkvdtraleevglteaqaqemyrylaianyedrfvvpsshrelareafpekngcgftf
gdgchgsdtkfnlfnsrridaidvtskte

SCOPe Domain Coordinates for d1q16b_:

Click to download the PDB-style file with coordinates for d1q16b_.
(The format of our PDB-style files is described here.)

Timeline for d1q16b_: