Lineage for d1q16a1 (1q16 A:1075-1244)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 467143Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 467166Superfamily b.52.2: ADC-like [50692] (3 families) (S)
  5. 467190Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (9 proteins)
    molybdopterine enzyme
  6. 467238Protein Respiratory nitrate reductase 1 alpha chain [101828] (1 species)
  7. 467239Species Escherichia coli [TaxId:562] [101829] (3 PDB entries)
  8. 467240Domain d1q16a1: 1q16 A:1075-1244 [95546]
    Other proteins in same PDB: d1q16a2, d1q16b_, d1q16c_

Details for d1q16a1

PDB Entry: 1q16 (more details), 1.9 Å

PDB Description: Crystal structure of Nitrate Reductase A, NarGHI, from Escherichia coli

SCOP Domain Sequences for d1q16a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q16a1 b.52.2.2 (A:1075-1244) Respiratory nitrate reductase 1 alpha chain {Escherichia coli}
gqksngnqekalnfltphqkwgihstysdnllmltlgrggpvvwlseadakdlgiadndw
ievfnsngaltaravvsqrvpagmtmmyhaqerivnlpgseitqqrggihnsvtritpkp
thmiggyahlaygfnyygtvgsnrdefvvvrkmknidwldgegndqvqes

SCOP Domain Coordinates for d1q16a1:

Click to download the PDB-style file with coordinates for d1q16a1.
(The format of our PDB-style files is described here.)

Timeline for d1q16a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1q16a2