Lineage for d1q15d1 (1q15 D:206-500)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2861263Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2861264Family c.26.2.1: N-type ATP pyrophosphatases [52403] (9 proteins)
  6. 2861311Protein beta-Lactam synthetase [69456] (2 species)
    Asparagine synthetase B homologue
  7. 2861312Species Pectobacterium carotovorum [TaxId:554] [102263] (2 PDB entries)
    carbapenam synthetase CarA
  8. 2861316Domain d1q15d1: 1q15 D:206-500 [95544]
    Other proteins in same PDB: d1q15a2, d1q15b2, d1q15c2, d1q15d2
    has additional insertions and/or extensions that are not grouped together

Details for d1q15d1

PDB Entry: 1q15 (more details), 2.3 Å

PDB Description: Carbapenam Synthetase
PDB Compounds: (D:) CarA

SCOPe Domain Sequences for d1q15d1:

Sequence, based on SEQRES records: (download)

>d1q15d1 c.26.2.1 (D:206-500) beta-Lactam synthetase {Pectobacterium carotovorum [TaxId: 554]}
pasnqllalprepllalidrylnapledlaprfdtvgiplsggldsslvtalasrhfkkl
ntysigtelsnefefsqqvadalgthhqmkilsetevingiiesiyyneifdglsaeiqs
glfnvyrqaqgqvscmltgygsdllfggilkpgaqydnpnqllaeqvyrtrwtgefathg
ascygidirhpfwshslislchalhpdykifdnevknilreyadslqllpkdivwrkkig
ihegssvnqafanvlgstvdnyqtksrftyrvyqaflrgrlsitdvtpsqlkdli

Sequence, based on observed residues (ATOM records): (download)

>d1q15d1 c.26.2.1 (D:206-500) beta-Lactam synthetase {Pectobacterium carotovorum [TaxId: 554]}
pasnqllalprepllalidrylnapledlaprfdtvgiplsggldsslvtalasrhfkkl
ntysigtelsnefefsqqvadalgthhqmkilsetevingiiesiyyneifdglsaeiqs
glfnvyrqaqgqvscmltgygsdllfggilkpgaqydnpnqllaeqvyrtrwtgefathg
ascygidirhpfwshslislchalhpdykifdnevknilreyadslqllpkdivwrqtks
rftyrvyqaflrgrlsitdvtpsqlkdli

SCOPe Domain Coordinates for d1q15d1:

Click to download the PDB-style file with coordinates for d1q15d1.
(The format of our PDB-style files is described here.)

Timeline for d1q15d1: