SCOPe 2.03: Domain d1q15c1: 1q15 C:206-501

Lineage for d1q15c1 (1q15 C:206-501)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.1: N-type ATP pyrophosphatases [52403] (9 proteins)

6. Protein beta-Lactam synthetase [69456] (2 species)
   Asparagine synthetase B homologue

7. Species Pectobacterium carotovorum [TaxId:554] [102263] (2 PDB entries)
   carbapenam synthetase CarA

8. Domain d1q15c1: 1q15 C:206-501 [95542]
   Other proteins in same PDB: d1q15a2, d1q15b2, d1q15c2, d1q15d2

Details for d1q15c1

PDB Entry: 1q15, 2.3 Å

PDB Description: Carbapenam Synthetase

PDB Compounds: (C:) CarA

SCOPe Domain Sequences for d1q15c1:

Sequence, based on SEQRES records:

>d1q15c1 c.26.2.1 (C:206-501) beta-Lactam synthetase {Pectobacterium carotovorum [TaxId: 554]}
pasnqllalprepllalidrylnapledlaprfdtvgiplsggldsslvtalasrhfkkl
ntysigtelsnefefsqqvadalgthhqmkilsetevingiiesiyyneifdglsaeiqs
glfnvyrqaqgqvscmltgygsdllfggilkpgaqydnpnqllaeqvyrtrwtgefathg
ascygidirhpfwshslislchalhpdykifdnevknilreyadslqllpkdivwrkkig
ihegssvnqafanvlgstvdnyqtksrftyrvyqaflrgrlsitdvtpsqlkdlik

Sequence, based on observed residues (ATOM records):

>d1q15c1 c.26.2.1 (C:206-501) beta-Lactam synthetase {Pectobacterium carotovorum [TaxId: 554]}
pasnqllalprepllalidrylnapledlaprfdtvgiplsggldsslvtalasrhfkkl
ntysigtelsnefefsqqvadalgthhqmkilsetevingiiesiyyneifdglsaeiqs
glfnvyrqaqgqvscmltgygsdllfggilkpgaqydnpnqllaeqvyrtrwtgefathg
ascygidirhpfwshslislchalhpdykifdnevknilreyadslqllpkdivwrsvnq
afanvlgstvdnyqtksrftyrvyqaflrgrlsitdvtpsqlkdlik

Timeline for d1q15c1:

• d1q15c1 first appeared in SCOP 1.67
  
• d1q15c1 appears in SCOPe 2.02
  
• d1q15c1 appears in SCOPe 2.04
  
• d1q15c1 appears in the current release, SCOPe 2.08