![]() | Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
![]() | Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (5 families) ![]() share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
![]() | Family c.26.2.1: N-type ATP pyrophosphatases [52403] (6 proteins) |
![]() | Protein beta-Lactam synthetase [69456] (2 species) Asparagine synthetase B homologue |
![]() | Species Pectobacterium carotovorum [TaxId:554] [102263] (2 PDB entries) carbapenam synthetase CarA |
![]() | Domain d1q15b1: 1q15 B:206-501 [95540] Other proteins in same PDB: d1q15a2, d1q15b2, d1q15c2, d1q15d2 |
PDB Entry: 1q15 (more details), 2.3 Å
SCOP Domain Sequences for d1q15b1:
Sequence, based on SEQRES records: (download)
>d1q15b1 c.26.2.1 (B:206-501) beta-Lactam synthetase {Pectobacterium carotovorum} pasnqllalprepllalidrylnapledlaprfdtvgiplsggldsslvtalasrhfkkl ntysigtelsnefefsqqvadalgthhqmkilsetevingiiesiyyneifdglsaeiqs glfnvyrqaqgqvscmltgygsdllfggilkpgaqydnpnqllaeqvyrtrwtgefathg ascygidirhpfwshslislchalhpdykifdnevknilreyadslqllpkdivwrkkig ihegssvnqafanvlgstvdnyqtksrftyrvyqaflrgrlsitdvtpsqlkdlik
>d1q15b1 c.26.2.1 (B:206-501) beta-Lactam synthetase {Pectobacterium carotovorum} pasnqllalprepllalidrylnapledlaprfdtvgiplsggldsslvtalasrhfkkl ntysigtelsnefefsqqvadalgthhqmkilsetevingiiesiyyneifdglsaeiqs glfnvyrqaqgqvscmltgygsdllfggilkpgaqydnpnqllaeqvyrtrwtgefathg ascygidirhpfwshslislchalhpdykifdnevknilreyadslqllpkdivwrsvnq afanvlgstvdnyqtksrftyrvyqaflrgrlsitdvtpsqlkdlik
Timeline for d1q15b1: