Lineage for d1q14a1 (1q14 A:1-314)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2107255Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2107256Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2107522Family c.31.1.5: Sir2 family of transcriptional regulators [63984] (8 protein domains)
    silent information regulator 2; contains insertion of a rubredoxin-like zinc finger domain
  6. 2107546Protein Hst2 [102294] (1 species)
  7. 2107547Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [102295] (5 PDB entries)
    Uniprot P53686 1-293
  8. 2107551Domain d1q14a1: 1q14 A:1-314 [95537]
    Other proteins in same PDB: d1q14a2
    complexed with cl, zn

Details for d1q14a1

PDB Entry: 1q14 (more details), 2.5 Å

PDB Description: Structure and autoregulation of the yeast Hst2 homolog of Sir2
PDB Compounds: (A:) HST2 protein

SCOPe Domain Sequences for d1q14a1:

Sequence, based on SEQRES records: (download)

>d1q14a1 c.31.1.5 (A:1-314) Hst2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
msvstastemsvrkiaahmksnpnakvifmvgagistscgipdfrspgtglyhnlarlkl
pypeavfdvdffqsdplpfytlakelypgnfrpskfhyllklfqdkdvlkrvytqnidtl
erqagvkddliieahgsfahchcigcgkvyppqvfksklaehpikdfvkcdvcgelvkpa
ivffgedlpdsfsetwlndsewlrekittsgkhpqqplvivvgtslavypfaslpeeipr
kvkrvlcnletvgdfkankrptdlivhqysdefaeqlveelgwqedfekiltaqggmgdn
skeqlleivhdlen

Sequence, based on observed residues (ATOM records): (download)

>d1q14a1 c.31.1.5 (A:1-314) Hst2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
msvstastemsvrkiaahmksnpnakvifmvgagistscglarlklpypeavfdvdffqs
dplpfytlakelypgnfrpskfhyllklfqdkdvlkrvytqnidtlerqagvkddliiea
hgsfahchcigcgkvyppqvfksklaehpikdfvkcdvcgelvkpaivffgedlpdsfse
twlndsewlrekqqplvivvgtslavypfaslpeeiprkvkrvlcnletvgdfkankrpt
dlivhqysdefaeqlveelgwqedfekiltaqkeqlleivhdlen

SCOPe Domain Coordinates for d1q14a1:

Click to download the PDB-style file with coordinates for d1q14a1.
(The format of our PDB-style files is described here.)

Timeline for d1q14a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1q14a2