SCOPe 2.05: Domain d1q12b2: 1q12 B:4-235

Lineage for d1q12b2 (1q12 B:4-235)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.12: ABC transporter ATPase domain-like [52686] (24 proteins)
   there are two additional subdomains inserted into the central core that has a RecA-like topology

6. Protein Maltose transport protein MalK, N-terminal domain [52689] (2 species)

7. Species Escherichia coli [TaxId:562] [102380] (15 PDB entries)

8. Domain d1q12b2: 1q12 B:4-235 [95532]
   Other proteins in same PDB: d1q12a1, d1q12b1, d1q12c1, d1q12d1
   complexed with atp

Details for d1q12b2

PDB Entry: 1q12, 2.6 Å

PDB Description: Crystal Structure of the ATP-bound E. coli MalK

PDB Compounds: (B:) Maltose/maltodextrin transport ATP-binding protein malK

SCOPe Domain Sequences for d1q12b2:

Sequence; same for both SEQRES and ATOM records:

>d1q12b2 c.37.1.12 (B:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]}
vqlqnvtkawgevvvskdinldihegefvvfvgpsgcgkstllrmiagletitsgdlfig
ekrmndtppaergvgmvfqsyalyphlsvaenmsfglklagakkevinqrvnqvaevlql
ahlldrkpkalsggqrqrvaigrtlvaepsvflldeplsnldaalrvqmrieisrlhkrl
grtmiyvthdqveamtladkivvldagrvaqvgkplelyhypadrfvagfig

Timeline for d1q12b2:

• d1q12b2 first appeared in SCOP 1.67
  
• d1q12b2 appears in SCOPe 2.04
  
• d1q12b2 appears in SCOPe 2.06
  
• d1q12b2 appears in the current release, SCOPe 2.08