Lineage for d1q0za_ (1q0z A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901654Family c.69.1.28: Aclacinomycin methylesterase RdmC [102620] (1 protein)
    automatically mapped to Pfam PF12697
  6. 2901655Protein Aclacinomycin methylesterase RdmC [102621] (1 species)
  7. 2901656Species Streptomyces purpurascens [TaxId:1924] [102622] (2 PDB entries)
  8. 2901658Domain d1q0za_: 1q0z A: [95525]
    complexed with 1pe, aka, so4

Details for d1q0za_

PDB Entry: 1q0z (more details), 1.95 Å

PDB Description: crystal structure of aclacinomycin methylesterase (rdmc) with bound product analogue, 10-decarboxymethylaclacinomycin a (dcma)
PDB Compounds: (A:) aclacinomycin methylesterase

SCOPe Domain Sequences for d1q0za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q0za_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]}
serivpsgdvelwsddfgdpadpalllvmggnlsalgwpdefarrladgglhvirydhrd
tgrsttrdfaahpygfgelaadavavldgwgvdrahvvglsmgatitqvialdhhdrlss
ltmllgggldidfdaniervmrgeptldglpgpqqpfldalalmnqpaegraaevakrvs
kwrilsgtgvpfddaeyarweeraidhaggvlaepyahysltlpppsraaelrevtvptl
viqaehdpiapaphgkhlagliptarlaeipgmghalpssvhgplaevilahtrsaa

SCOPe Domain Coordinates for d1q0za_:

Click to download the PDB-style file with coordinates for d1q0za_.
(The format of our PDB-style files is described here.)

Timeline for d1q0za_: