Lineage for d1q0wb_ (1q0w B:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 499486Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 499487Superfamily d.15.1: Ubiquitin-like [54236] (6 families) (S)
  5. 499488Family d.15.1.1: Ubiquitin-related [54237] (17 proteins)
  6. 499533Protein Ubiquitin [54238] (3 species)
  7. 499534Species Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId:4932] [89830] (2 PDB entries)
  8. 499536Domain d1q0wb_: 1q0w B: [95516]
    Other proteins in same PDB: d1q0wa_

Details for d1q0wb_

PDB Entry: 1q0w (more details)

PDB Description: solution structure of vps27 amino-terminal uim-ubiquitin complex

SCOP Domain Sequences for d1q0wb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q0wb_ d.15.1.1 (B:) Ubiquitin {Baker's yeast (Saccharomyces cerevisiae), smt3}
mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn
iqkestlhlvlrlrgg

SCOP Domain Coordinates for d1q0wb_:

Click to download the PDB-style file with coordinates for d1q0wb_.
(The format of our PDB-style files is described here.)

Timeline for d1q0wb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1q0wa_