SCOPe 2.08: Domain d1q0ua_: 1q0u A:

Lineage for d1q0ua_ (1q0u A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins)
   duplication: tandem repeat of two RecA-like (AAA) domains

6. Protein Probable DEAD box RNA helicase YqfR [102383] (1 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [102384] (1 PDB entry)

8. Domain d1q0ua_: 1q0u A: [95512]
   N-terminal domain only
   has additional insertions and/or extensions that are not grouped together

Details for d1q0ua_

PDB Entry: 1q0u, 1.85 Å

PDB Description: Crystal Structure of the BstDEAD N-terminal Domain

PDB Compounds: (A:) BstDEAD

SCOPe Domain Sequences for d1q0ua_:

Sequence; same for both SEQRES and ATOM records:

>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]}
tqftrfpfqpfiieaiktlrfykpteiqeriipgalrgesmvgqsqtgtgkthayllpim
ekikperaevqavitaptrelatqiyhetlkitkfcpkdrmivarcliggtdkqkalekl
nvqphivigtpgrindfireqaldvhtahilvvdeadlmldmgfitdvdqiaarmpkdlq
mlvfsatipeklkpflkkymenptfvhvl

Timeline for d1q0ua_:

• d1q0ua_ first appeared in SCOP 1.67
  
• d1q0ua_ appears in SCOPe 2.07