Lineage for d1q0ta_ (1q0t A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130081Family c.66.1.28: N6 adenine-specific DNA methylase, DAM [88788] (3 protein domains)
    automatically mapped to Pfam PF02086
  6. 2130085Protein DNA methylase T4DAM [102584] (2 species)
  7. 2130086Species Bacteriophage T4 [TaxId:10665] [102585] (5 PDB entries)
  8. 2130100Domain d1q0ta_: 1q0t A: [95510]
    complexed with DNA
    protein/DNA complex; complexed with iod, sah

Details for d1q0ta_

PDB Entry: 1q0t (more details), 3.1 Å

PDB Description: Ternary Structure of T4DAM with AdoHcy and DNA
PDB Compounds: (A:) DNA adenine methylase

SCOPe Domain Sequences for d1q0ta_:

Sequence, based on SEQRES records: (download)

>d1q0ta_ c.66.1.28 (A:) DNA methylase T4DAM {Bacteriophage T4 [TaxId: 10665]}
mlgaiaytgnkqsllpelkshfpkynrfvdlfcgglsvslnvngpvlandiqepiiemyk
rlinvswddvlkvikqyklsktskeeflklredynktrdplllyvlhfhgfsnmirindk
gnfttpfgkrtinknsekqynhfkqncdkiifsslhfkdvkildgdfvyvdppylitvad
ynkfwsedeekdllnlldslndrgikfgqsnvlehhgkentllkewskkynvkhlnkkyv
fniyhskekngtdevyifn

Sequence, based on observed residues (ATOM records): (download)

>d1q0ta_ c.66.1.28 (A:) DNA methylase T4DAM {Bacteriophage T4 [TaxId: 10665]}
mlgaiaytgnkqsllpelkshfpkynrfvdlfcgglsvslnvngpvlandiqepiiemyk
rlinvswddvlkvikqyklsktskeeflklredynktrdplllyvlhfhgfsnmirindk
gnfttpfgkrtinknsekqynhfkqncdkiifsslhfkdvkildgdfvyvdppylitvad
ynkfwsedeekdllnlldslndrgikfgqsnvlehhgkentllkewskkynvkhlevyif
n

SCOPe Domain Coordinates for d1q0ta_:

Click to download the PDB-style file with coordinates for d1q0ta_.
(The format of our PDB-style files is described here.)

Timeline for d1q0ta_: