Lineage for d1q0pa_ (1q0p A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2128912Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2128913Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 2128914Family c.62.1.1: Integrin A (or I) domain [53301] (11 protein domains)
  6. 2128920Protein Complement factor B domain [102541] (1 species)
  7. 2128921Species Human (Homo sapiens) [TaxId:9606] [102542] (5 PDB entries)
    Uniprot P00751 268-764
  8. 2128922Domain d1q0pa_: 1q0p A: [95507]
    complexed with mn

Details for d1q0pa_

PDB Entry: 1q0p (more details), 1.8 Å

PDB Description: A domain of Factor B
PDB Compounds: (A:) complement factor b

SCOPe Domain Sequences for d1q0pa_:

Sequence, based on SEQRES records: (download)

>d1q0pa_ c.62.1.1 (A:) Complement factor B domain {Human (Homo sapiens) [TaxId: 9606]}
smniylvldgsdsigasnftgakkslvnliekvasygvkpryglvtyatypkiwvkvsea
dssnadwvtkqlneinyedhklksgtntkkalqavysmmswpddvppegwnrtrhviilm
tdglhnmggdpitvideirdllyigkdrknpredyldvyvfgvgplvnqvninalaskkd
neqhvfkvkdmenledvfyqmidesqsls

Sequence, based on observed residues (ATOM records): (download)

>d1q0pa_ c.62.1.1 (A:) Complement factor B domain {Human (Homo sapiens) [TaxId: 9606]}
smniylvldgsdsigasnftgakkslvnliekvasygvkpryglvtyatypkiwvkvsea
dssnadwvtkqlneinyedhklksgtntkkalqavysmmswpddvppegwnrtrhviilm
tdglhnmggdpitvideirdllyigkdrknpredyldvyvfgvgplvnqvninalaskkd
neqhvfkvkdls

SCOPe Domain Coordinates for d1q0pa_:

Click to download the PDB-style file with coordinates for d1q0pa_.
(The format of our PDB-style files is described here.)

Timeline for d1q0pa_: