SCOP 1.67: Domain d1q0eb_: 1q0e B:

Lineage for d1q0eb_ (1q0e B:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins)

6. Protein Cu,Zn superoxide dismutase, SOD [49331] (9 species)

7. Species Cow (Bos taurus) [TaxId:9913] [49332] (16 PDB entries)

8. Domain d1q0eb_: 1q0e B: [95505]
   complexed with ace, cu, zn

Details for d1q0eb_

PDB Entry: 1q0e, 1.15 Å

PDB Description: Atomic resolution (1.15 ) crystal structure of bovine copper, zinc superoxide dismutase

SCOP Domain Sequences for d1q0eb_:

Sequence; same for both SEQRES and ATOM records:

>d1q0eb_ b.1.8.1 (B:) Cu,Zn superoxide dismutase, SOD {Cow (Bos taurus)}
atkavcvlkgdgpvqgtihfeakgdtvvvtgsitgltegdhgfhvhqfgdntqgctsagp
hfnplskkhggpkdeerhvgdlgnvtadkngvaivdivdplislsgeysiigrtmvvhek
pddlgrggneestktgnagsrlacgvigiak

Timeline for d1q0eb_:

• d1q0eb_ is new in SCOP 1.67
  
• d1q0eb_ appears in SCOP 1.69
  
• d1q0eb_ appears in the current release, SCOPe 2.08