Lineage for d1q0ea_ (1q0e A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 367295Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family) (S)
    has additional strand at N-terminus
  5. 367296Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins)
  6. 367309Protein Cu,Zn superoxide dismutase, SOD [49331] (9 species)
  7. 367338Species Cow (Bos taurus) [TaxId:9913] [49332] (16 PDB entries)
  8. 367339Domain d1q0ea_: 1q0e A: [95504]

Details for d1q0ea_

PDB Entry: 1q0e (more details), 1.15 Å

PDB Description: Atomic resolution (1.15 ) crystal structure of bovine copper, zinc superoxide dismutase

SCOP Domain Sequences for d1q0ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q0ea_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Cow (Bos taurus)}
atkavcvlkgdgpvqgtihfeakgdtvvvtgsitgltegdhgfhvhqfgdntqgctsagp
hfnplskkhggpkdeerhvgdlgnvtadkngvaivdivdplislsgeysiigrtmvvhek
pddlgrggneestktgnagsrlacgvigiak

SCOP Domain Coordinates for d1q0ea_:

Click to download the PDB-style file with coordinates for d1q0ea_.
(The format of our PDB-style files is described here.)

Timeline for d1q0ea_: