Lineage for d1q06b_ (1q06 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2308672Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
    core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different
  4. 2308673Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families) (S)
  5. 2308706Family a.6.1.3: DNA-binding N-terminal domain of transcription activators [46962] (5 protein domains)
    includes a dimerisation, antiparallel coiled-coil subdomain
  6. 2308718Protein Transcriptional regulator CueR [101073] (1 species)
    copper efflux regulator
  7. 2308719Species Escherichia coli [TaxId:562] [101074] (3 PDB entries)
  8. 2308721Domain d1q06b_: 1q06 B: [95494]
    complexed with ag

Details for d1q06b_

PDB Entry: 1q06 (more details), 2.07 Å

PDB Description: Crystal structure of the Ag(I) form of E. coli CueR, a copper efflux regulator
PDB Compounds: (B:) Transcriptional regulator cueR

SCOPe Domain Sequences for d1q06b_:

Sequence, based on SEQRES records: (download)

>d1q06b_ a.6.1.3 (B:) Transcriptional regulator CueR {Escherichia coli [TaxId: 562]}
mnisdvakitgltskairfyeekglvtppmrsengyrtytqqhlneltllrqarqvgfnl
eesgelvnlfndpqrhsadvkrrtlekvaeierhieelqsmrdqllalanacpgddsadc
piienls

Sequence, based on observed residues (ATOM records): (download)

>d1q06b_ a.6.1.3 (B:) Transcriptional regulator CueR {Escherichia coli [TaxId: 562]}
mnisdvakitgltskairfyeekglvtppmrsengyrtytqqhlneltllrqarqvgfnl
eesgelvnlfndpqhsadvkrrtlekvaeierhieelqsmrdqllalanacpgddsadcp
iienls

SCOPe Domain Coordinates for d1q06b_:

Click to download the PDB-style file with coordinates for d1q06b_.
(The format of our PDB-style files is described here.)

Timeline for d1q06b_: