SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1q06b_ (1q06 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1985062Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
    core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different
  4. 1985063Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families) (S)
  5. 1985096Family a.6.1.3: DNA-binding N-terminal domain of transcription activators [46962] (5 protein domains)
    includes a dimerisation, antiparallel coiled-coil subdomain
  6. 1985108Protein Transcriptional regulator CueR [101073] (1 species)
    copper efflux regulator
  7. 1985109Species Escherichia coli [TaxId:562] [101074] (3 PDB entries)
  8. 1985111Domain d1q06b_: 1q06 B: [95494]
    complexed with ag

Details for d1q06b_

PDB Entry: 1q06 (more details), 2.07 Å

PDB Description: Crystal structure of the Ag(I) form of E. coli CueR, a copper efflux regulator
PDB Compounds: (B:) Transcriptional regulator cueR

SCOPe Domain Sequences for d1q06b_:

Sequence, based on SEQRES records: (download)

>d1q06b_ a.6.1.3 (B:) Transcriptional regulator CueR {Escherichia coli [TaxId: 562]}
mnisdvakitgltskairfyeekglvtppmrsengyrtytqqhlneltllrqarqvgfnl
eesgelvnlfndpqrhsadvkrrtlekvaeierhieelqsmrdqllalanacpgddsadc
piienls

Sequence, based on observed residues (ATOM records): (download)

>d1q06b_ a.6.1.3 (B:) Transcriptional regulator CueR {Escherichia coli [TaxId: 562]}
mnisdvakitgltskairfyeekglvtppmrsengyrtytqqhlneltllrqarqvgfnl
eesgelvnlfndpqhsadvkrrtlekvaeierhieelqsmrdqllalanacpgddsadcp
iienls

SCOPe Domain Coordinates for d1q06b_:

Click to download the PDB-style file with coordinates for d1q06b_.
(The format of our PDB-style files is described here.)

Timeline for d1q06b_: