Lineage for d1q05b_ (1q05 B:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
    core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different
  4. Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families) (S)
  5. Family a.6.1.3: DNA-binding N-terminal domain of transcription activators [46962] (5 proteins)
    includes a dimerisation, antiparallel coiled-coil subdomain
  6. Protein Transcriptional regulator CueR [101073] (1 species)
    copper efflux regulator
  7. Species Escherichia coli [TaxId:562] [101074] (3 PDB entries)
  8. Domain d1q05b_: 1q05 B: [95492]
    complexed with cu1

Details for d1q05b_

PDB Entry: 1q05 (more details), 2.2 Å

PDB Description: Crystal structure of the Cu(I) form of E. coli CueR, a copper efflux regulator
PDB Compounds: (B:) Transcriptional regulator cueR

SCOPe Domain Sequences for d1q05b_:

Sequence, based on SEQRES records: (download)

>d1q05b_ a.6.1.3 (B:) Transcriptional regulator CueR {Escherichia coli [TaxId: 562]}
mnisdvakitgltskairfyeekglvtppmrsengyrtytqqhlneltllrqarqvgfnl
eesgelvnlfndpqrhsadvkrrtlekvaeierhieelqsmrdqllalanacpgddsadc
piienlsg

Sequence, based on observed residues (ATOM records): (download)

>d1q05b_ a.6.1.3 (B:) Transcriptional regulator CueR {Escherichia coli [TaxId: 562]}
mnisdvakitgltskairfyeekglvtppmrsengyrtytqqhlneltllrqarqvgfnl
eesgelvnlfndpqhsadvkrrtlekvaeierhieelqsmrdqllalanacpgddsadcp
iienlsg

SCOPe Domain Coordinates for d1q05b_ are not available.

Timeline for d1q05b_:

Domains from other chains:
(mouse over for more information)
d1q05a_