Lineage for d1q02a_ (1q02 A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1723911Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 1723935Superfamily a.5.2: UBA-like [46934] (5 families) (S)
  5. 1723936Family a.5.2.1: UBA domain [46935] (25 proteins)
  6. 1723971Protein Sequestosome 1 (Sqstm1) [101063] (1 species)
    ubiquitin-binding protein p62
  7. 1723972Species Human (Homo sapiens) [TaxId:9606] [101064] (5 PDB entries)
  8. 1723977Domain d1q02a_: 1q02 A: [95490]

Details for d1q02a_

PDB Entry: 1q02 (more details)

PDB Description: nmr structure of the uba domain of p62 (sqstm1)
PDB Compounds: (A:) sequestosome 1

SCOPe Domain Sequences for d1q02a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q02a_ a.5.2.1 (A:) Sequestosome 1 (Sqstm1) {Human (Homo sapiens) [TaxId: 9606]}
gsppeadprlieslsqmlsmgfsdeggwltrllqtknydigaaldtiqyskh

SCOPe Domain Coordinates for d1q02a_:

Click to download the PDB-style file with coordinates for d1q02a_.
(The format of our PDB-style files is described here.)

Timeline for d1q02a_: