Lineage for d1pzyd_ (1pzy D:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1614914Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 1614915Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 1614924Family c.68.1.2: beta 1,4 galactosyltransferase (b4GalT1) [53452] (2 proteins)
  6. 1614925Protein beta 1,4 galactosyltransferase (b4GalT1) [53453] (1 species)
  7. 1614926Species Cow (Bos taurus) [TaxId:9913] [53454] (20 PDB entries)
    Uniprot P08037 131-402
  8. 1614953Domain d1pzyd_: 1pzy D: [95489]
    Other proteins in same PDB: d1pzya_, d1pzyc_
    complexed with ca, mn, nag, udp

Details for d1pzyd_

PDB Entry: 1pzy (more details), 2.3 Å

PDB Description: w314a-beta1,4-galactosyltransferase-i complexed with alpha-lactalbumin in the presence of n-acetylglucosamine, udp and manganese
PDB Compounds: (D:) beta-1,4-galactosyltransferase

SCOPe Domain Sequences for d1pzyd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pzyd_ c.68.1.2 (D:) beta 1,4 galactosyltransferase (b4GalT1) {Cow (Bos taurus) [TaxId: 9913]}
tacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdcisphkvaiiipfrnr
qehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgfkealkdydyncfvfs
dvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsalskqqflsingfpnny
wgaggedddiynrlafrgmsvsrpnavigktrmirhsrdkknepnpqrfdriahtketml
sdglnsltymvlevqryplytkitvdigtps

SCOPe Domain Coordinates for d1pzyd_:

Click to download the PDB-style file with coordinates for d1pzyd_.
(The format of our PDB-style files is described here.)

Timeline for d1pzyd_: