Lineage for d1pzya_ (1pzy A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 405476Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 405477Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 405486Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 405487Protein alpha-Lactalbumin [53975] (6 species)
    expressed only in the lactating mammary gland, strongly binds calcium ion
  7. 405519Species Mouse (Mus musculus) [TaxId:10090] [69628] (9 PDB entries)
  8. 405530Domain d1pzya_: 1pzy A: [95486]
    Other proteins in same PDB: d1pzyb_, d1pzyd_

Details for d1pzya_

PDB Entry: 1pzy (more details), 2.3 Å

PDB Description: w314a-beta1,4-galactosyltransferase-i complexed with alpha-lactalbumin in the presence of n-acetylglucosamine, udp and manganese

SCOP Domain Sequences for d1pzya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pzya_ d.2.1.2 (A:) alpha-Lactalbumin {Mouse (Mus musculus)}
teltkckvshaikdidgyqgisllewacvlfhtsgydtqavvndngsteyglfqisdrfw
ckssefpesenicgiscdkllddeldddiacakkilaikgidywkaykpmcsekleqwrc
ekp

SCOP Domain Coordinates for d1pzya_:

Click to download the PDB-style file with coordinates for d1pzya_.
(The format of our PDB-style files is described here.)

Timeline for d1pzya_: