Lineage for d1pzxb_ (1pzx B:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 595119Fold c.119: DAK1/DegV-like [82548] (1 superfamily)
    2 different domains; d1: [core: 3 layers, a/b/a; parallel sheet of 5 strands, order: 2134]; D2: [2 layers, a/b; mixed sheet of 6 strands, order 321645; strands 2 and 6 are antiparallel to the rest]
  4. 595120Superfamily c.119.1: DAK1/DegV-like [82549] (2 families) (S)
    domain folds and architecture show some similarity to the tubulin-like GTPases; the nucleotide-binding sites of the Dihydroxyacetone kinase and tubulin families are different
  5. 595121Family c.119.1.1: DegV-like [82550] (2 proteins)
    Pfam 02645, DUF194
  6. 595122Protein Hypothetical protein apc36103 [102686] (1 species)
    lipid-binding protein; Bacilus subtilis YitS ortholog
  7. 595123Species Bacillus stearothermophilus [TaxId:1422] [102687] (1 PDB entry)
  8. 595125Domain d1pzxb_: 1pzx B: [95485]
    structural genomics
    complexed with plm

Details for d1pzxb_

PDB Entry: 1pzx (more details), 2 Å

PDB Description: hypothetical protein apc36103 from bacillus stearothermophilus: a lipid binding protein

SCOP Domain Sequences for d1pzxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pzxb_ c.119.1.1 (B:) Hypothetical protein apc36103 {Bacillus stearothermophilus}
nampieiitdsgadlpqsyirehriaflplvvhwngqdykdgitiepkqvydamrqghtv
ktaqpsplamkelflpyakenrpclyiafssklsgtyqtamavrselldeypefrltiid
skcaslgqglavmkavelakqntpynllcetiesycrhmehiftvdnldylarggriskt
aaafggllnikpllhvedgaliplekwrgrkkvlkrmvelmgergddlqkqtigishadd
eetalelkqmieethgctrfflsdigsaigahagpgtialfflnkyiei

SCOP Domain Coordinates for d1pzxb_:

Click to download the PDB-style file with coordinates for d1pzxb_.
(The format of our PDB-style files is described here.)

Timeline for d1pzxb_: