SCOP 1.69: Domain d1pzxb_: 1pzx B:

Lineage for d1pzxb_ (1pzx B:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.119: DAK1/DegV-like [82548] (1 superfamily)
   2 different domains; d1: [core: 3 layers, a/b/a; parallel sheet of 5 strands, order: 2134]; D2: [2 layers, a/b; mixed sheet of 6 strands, order 321645; strands 2 and 6 are antiparallel to the rest]

4. Superfamily c.119.1: DAK1/DegV-like [82549] (2 families)
   domain folds and architecture show some similarity to the tubulin-like GTPases; the nucleotide-binding sites of the Dihydroxyacetone kinase and tubulin families are different

5. Family c.119.1.1: DegV-like [82550] (2 proteins)
   Pfam 02645, DUF194

6. Protein Hypothetical protein apc36103 [102686] (1 species)
   lipid-binding protein; Bacilus subtilis YitS ortholog

7. Species Bacillus stearothermophilus [TaxId:1422] [102687] (1 PDB entry)

8. Domain d1pzxb_: 1pzx B: [95485]
   structural genomics

Details for d1pzxb_

PDB Entry: 1pzx, 2 Å

PDB Description: hypothetical protein apc36103 from bacillus stearothermophilus: a lipid binding protein

SCOP Domain Sequences for d1pzxb_:

Sequence; same for both SEQRES and ATOM records:

>d1pzxb_ c.119.1.1 (B:) Hypothetical protein apc36103 {Bacillus stearothermophilus}
nampieiitdsgadlpqsyirehriaflplvvhwngqdykdgitiepkqvydamrqghtv
ktaqpsplamkelflpyakenrpclyiafssklsgtyqtamavrselldeypefrltiid
skcaslgqglavmkavelakqntpynllcetiesycrhmehiftvdnldylarggriskt
aaafggllnikpllhvedgaliplekwrgrkkvlkrmvelmgergddlqkqtigishadd
eetalelkqmieethgctrfflsdigsaigahagpgtialfflnkyiei

Timeline for d1pzxb_:

• d1pzxb_ first appeared in SCOP 1.67
  
• d1pzxb_ appears in SCOP 1.71
  
• d1pzxb_ appears in the current release, SCOPe 2.08