![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.119: DAK1/DegV-like [82548] (1 superfamily) 2 different domains; d1: [core: 3 layers, a/b/a; parallel sheet of 5 strands, order: 2134]; D2: [2 layers, a/b; mixed sheet of 6 strands, order 321645; strands 2 and 6 are antiparallel to the rest] |
![]() | Superfamily c.119.1: DAK1/DegV-like [82549] (3 families) ![]() domain folds and architecture show some similarity to the tubulin-like GTPases; the nucleotide-binding sites of the Dihydroxyacetone kinase and tubulin families are different |
![]() | Family c.119.1.1: DegV-like [82550] (2 proteins) Pfam PF02645, DUF194 |
![]() | Protein Hypothetical protein apc36103 [102686] (1 species) lipid-binding protein; Bacilus subtilis YitS ortholog |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [102687] (1 PDB entry) |
![]() | Domain d1pzxb_: 1pzx B: [95485] structural genomics complexed with plm |
PDB Entry: 1pzx (more details), 2 Å
SCOPe Domain Sequences for d1pzxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pzxb_ c.119.1.1 (B:) Hypothetical protein apc36103 {Bacillus stearothermophilus [TaxId: 1422]} nampieiitdsgadlpqsyirehriaflplvvhwngqdykdgitiepkqvydamrqghtv ktaqpsplamkelflpyakenrpclyiafssklsgtyqtamavrselldeypefrltiid skcaslgqglavmkavelakqntpynllcetiesycrhmehiftvdnldylarggriskt aaafggllnikpllhvedgaliplekwrgrkkvlkrmvelmgergddlqkqtigishadd eetalelkqmieethgctrfflsdigsaigahagpgtialfflnkyiei
Timeline for d1pzxb_: