SCOP 1.73: Domain d1pzxa_: 1pzx A:

Lineage for d1pzxa_ (1pzx A:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.119: DAK1/DegV-like [82548] (1 superfamily)
   2 different domains; d1: [core: 3 layers, a/b/a; parallel sheet of 5 strands, order: 2134]; D2: [2 layers, a/b; mixed sheet of 6 strands, order 321645; strands 2 and 6 are antiparallel to the rest]

4. Superfamily c.119.1: DAK1/DegV-like [82549] (2 families)
   domain folds and architecture show some similarity to the tubulin-like GTPases; the nucleotide-binding sites of the Dihydroxyacetone kinase and tubulin families are different

5. Family c.119.1.1: DegV-like [82550] (2 proteins)
   Pfam PF02645, DUF194

6. Protein Hypothetical protein apc36103 [102686] (1 species)
   lipid-binding protein; Bacilus subtilis YitS ortholog

7. Species Bacillus stearothermophilus [TaxId:1422] [102687] (1 PDB entry)

8. Domain d1pzxa_: 1pzx A: [95484]

Details for d1pzxa_

PDB Entry: 1pzx, 2 Å

PDB Description: hypothetical protein apc36103 from bacillus stearothermophilus: a lipid binding protein

PDB Compounds: (A:) Hypothetical protein APC36103

SCOP Domain Sequences for d1pzxa_:

Sequence, based on SEQRES records:

>d1pzxa_ c.119.1.1 (A:) Hypothetical protein apc36103 {Bacillus stearothermophilus [TaxId: 1422]}
mpieiitdsgadlpqsyirehriaflplvvhwngqdykdgitiepkqvydamrqghtvkt
aqpsplamkelflpyakenrpclyiafssklsgtyqtamavrselldeypefrltiidsk
caslgqglavmkavelakqntpynllcetiesycrhmehiftvdnldylarggrisktaa
afggllnikpllhvedgaliplekwrgrkkvlkrmvelmgergddlqkqtigishaddee
talelkqmieethgctrfflsdigsaigahagpgtialfflnkyiei

Sequence, based on observed residues (ATOM records):

>d1pzxa_ c.119.1.1 (A:) Hypothetical protein apc36103 {Bacillus stearothermophilus [TaxId: 1422]}
mpieiitdsgadlpqsyirehriaflplvvhwngqdykdgitiepkqvydamrqghtvkt
aqpsplamkelflpyakenrpclyiafssklsgtyqtamavrselldeypefrltiidsk
caslgqglavmkavelakqntpynllcetiesycrhmehiftvdnldylarggrisnikp
llhvedgaliplekwrgrkkvlkrmvelmgergddlqkqtigishaddeetalelkqmie
ethgctrfflsdigsaigahagpgtialfflnkyiei

Timeline for d1pzxa_:

• d1pzxa_ first appeared in SCOP 1.67
  
• d1pzxa_ appears in SCOP 1.71
  
• d1pzxa_ appears in SCOP 1.75
  
• d1pzxa_ appears in the current release, SCOPe 2.08