Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.119: DegV-like [82548] (1 superfamily) consists of two non-similar domains Domain 1 has parallel sheet of 5 strands, order 21345, and antiparallel 3-stranded sheet, 132 Domain 2 has mixed sheet of 6 strands, order 321645; strands 2 and 6 are antiparallel to the rest |
Superfamily c.119.1: DegV-like [82549] (1 family) |
Family c.119.1.1: DegV-like [82550] (2 proteins) Pfam 02645, DUF194 |
Protein Hypothetical protein apc36103 [102686] (1 species) lipid-binding protein; Bacilus subtilis YitS ortholog |
Species Bacillus stearothermophilus [TaxId:1422] [102687] (1 PDB entry) |
Domain d1pzxa_: 1pzx A: [95484] |
PDB Entry: 1pzx (more details), 2 Å
SCOP Domain Sequences for d1pzxa_:
Sequence, based on SEQRES records: (download)
>d1pzxa_ c.119.1.1 (A:) Hypothetical protein apc36103 {Bacillus stearothermophilus} mpieiitdsgadlpqsyirehriaflplvvhwngqdykdgitiepkqvydamrqghtvkt aqpsplamkelflpyakenrpclyiafssklsgtyqtamavrselldeypefrltiidsk caslgqglavmkavelakqntpynllcetiesycrhmehiftvdnldylarggrisktaa afggllnikpllhvedgaliplekwrgrkkvlkrmvelmgergddlqkqtigishaddee talelkqmieethgctrfflsdigsaigahagpgtialfflnkyiei
>d1pzxa_ c.119.1.1 (A:) Hypothetical protein apc36103 {Bacillus stearothermophilus} mpieiitdsgadlpqsyirehriaflplvvhwngqdykdgitiepkqvydamrqghtvkt aqpsplamkelflpyakenrpclyiafssklsgtyqtamavrselldeypefrltiidsk caslgqglavmkavelakqntpynllcetiesycrhmehiftvdnldylarggrisnikp llhvedgaliplekwrgrkkvlkrmvelmgergddlqkqtigishaddeetalelkqmie ethgctrfflsdigsaigahagpgtialfflnkyiei
Timeline for d1pzxa_: