Lineage for d1pzxa_ (1pzx A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2921751Fold c.119: DAK1/DegV-like [82548] (1 superfamily)
    2 different domains; d1: [core: 3 layers, a/b/a; parallel sheet of 5 strands, order: 2134]; D2: [2 layers, a/b; mixed sheet of 6 strands, order 321645; strands 2 and 6 are antiparallel to the rest]
  4. 2921752Superfamily c.119.1: DAK1/DegV-like [82549] (3 families) (S)
    domain folds and architecture show some similarity to the tubulin-like GTPases; the nucleotide-binding sites of the Dihydroxyacetone kinase and tubulin families are different
  5. 2921753Family c.119.1.1: DegV-like [82550] (2 proteins)
    Pfam PF02645, DUF194
  6. 2921754Protein Hypothetical protein apc36103 [102686] (1 species)
    lipid-binding protein; Bacilus subtilis YitS ortholog
  7. 2921755Species Bacillus stearothermophilus [TaxId:1422] [102687] (1 PDB entry)
  8. 2921756Domain d1pzxa_: 1pzx A: [95484]
    structural genomics
    complexed with plm

Details for d1pzxa_

PDB Entry: 1pzx (more details), 2 Å

PDB Description: hypothetical protein apc36103 from bacillus stearothermophilus: a lipid binding protein
PDB Compounds: (A:) Hypothetical protein APC36103

SCOPe Domain Sequences for d1pzxa_:

Sequence, based on SEQRES records: (download)

>d1pzxa_ c.119.1.1 (A:) Hypothetical protein apc36103 {Bacillus stearothermophilus [TaxId: 1422]}
mpieiitdsgadlpqsyirehriaflplvvhwngqdykdgitiepkqvydamrqghtvkt
aqpsplamkelflpyakenrpclyiafssklsgtyqtamavrselldeypefrltiidsk
caslgqglavmkavelakqntpynllcetiesycrhmehiftvdnldylarggrisktaa
afggllnikpllhvedgaliplekwrgrkkvlkrmvelmgergddlqkqtigishaddee
talelkqmieethgctrfflsdigsaigahagpgtialfflnkyiei

Sequence, based on observed residues (ATOM records): (download)

>d1pzxa_ c.119.1.1 (A:) Hypothetical protein apc36103 {Bacillus stearothermophilus [TaxId: 1422]}
mpieiitdsgadlpqsyirehriaflplvvhwngqdykdgitiepkqvydamrqghtvkt
aqpsplamkelflpyakenrpclyiafssklsgtyqtamavrselldeypefrltiidsk
caslgqglavmkavelakqntpynllcetiesycrhmehiftvdnldylarggrisnikp
llhvedgaliplekwrgrkkvlkrmvelmgergddlqkqtigishaddeetalelkqmie
ethgctrfflsdigsaigahagpgtialfflnkyiei

SCOPe Domain Coordinates for d1pzxa_:

Click to download the PDB-style file with coordinates for d1pzxa_.
(The format of our PDB-style files is described here.)

Timeline for d1pzxa_: