Lineage for d1pzwa_ (1pzw A:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2586757Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 2586758Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 2587205Family g.39.1.10: Transcription factor grauzone Cg33133-Pa, zinc finger associated domain [103605] (1 protein)
    automatically mapped to Pfam PF07776
  6. 2587206Protein Transcription factor grauzone Cg33133-Pa, zinc finger associated domain [103606] (1 species)
    protein-protein interaction module
  7. 2587207Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [103607] (1 PDB entry)
  8. 2587208Domain d1pzwa_: 1pzw A: [95483]
    complexed with zn

Details for d1pzwa_

PDB Entry: 1pzw (more details), 2 Å

PDB Description: crystal structure of the zinc finger associated domain of the drosophila transcription factor grauzone
PDB Compounds: (A:) Transcription factor grauzone

SCOPe Domain Sequences for d1pzwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pzwa_ g.39.1.10 (A:) Transcription factor grauzone Cg33133-Pa, zinc finger associated domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
dicrlclrgvsgaqmclqifdvdsgeskvaevlrqhfwfevlpndeiskvicnvcwtqvs
efhqfyvsiqeaqviyatts

SCOPe Domain Coordinates for d1pzwa_:

Click to download the PDB-style file with coordinates for d1pzwa_.
(The format of our PDB-style files is described here.)

Timeline for d1pzwa_: