Lineage for d1pzum2 (1pzu M:399-571)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 789808Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 790093Superfamily b.2.5: p53-like transcription factors [49417] (7 families) (S)
  5. 790148Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (6 proteins)
  6. 790193Protein T-cell transcription factor NFAT1 (NFATC), DNA-binding domain [49421] (1 species)
  7. 790194Species Human (Homo sapiens) [TaxId:9606] [49422] (9 PDB entries)
  8. 790215Domain d1pzum2: 1pzu M:399-571 [95482]
    Other proteins in same PDB: d1pzub1, d1pzud1, d1pzuh1, d1pzui1, d1pzul1, d1pzum1

Details for d1pzum2

PDB Entry: 1pzu (more details), 3.1 Å

PDB Description: An asymmetric NFAT1-RHR homodimer on a pseudo-palindromic, Kappa-B site
PDB Compounds: (M:) Nuclear factor of activated T-cells, cytoplasmic 2

SCOP Domain Sequences for d1pzum2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pzum2 b.2.5.3 (M:399-571) T-cell transcription factor NFAT1 (NFATC), DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
wplssqsgsyelrievqpkphhrahyetegsrgavkaptgghpvvqlhgymenkplglqi
figtaderilkphafyqvhritgktvtttsyekivgntkvleiplepknnmratidcagi
lklrnadielrkgetdigrkntrvrlvfrvhipessgrivslqtasnpiecsq

SCOP Domain Coordinates for d1pzum2:

Click to download the PDB-style file with coordinates for d1pzum2.
(The format of our PDB-style files is described here.)

Timeline for d1pzum2: