![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.5: p53-like transcription factors [49417] (7 families) ![]() |
![]() | Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (6 proteins) |
![]() | Protein T-cell transcription factor NFAT1 (NFATC), DNA-binding domain [49421] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49422] (9 PDB entries) |
![]() | Domain d1pzum2: 1pzu M:399-571 [95482] Other proteins in same PDB: d1pzub1, d1pzud1, d1pzuh1, d1pzui1, d1pzul1, d1pzum1 |
PDB Entry: 1pzu (more details), 3.1 Å
SCOP Domain Sequences for d1pzum2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pzum2 b.2.5.3 (M:399-571) T-cell transcription factor NFAT1 (NFATC), DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} wplssqsgsyelrievqpkphhrahyetegsrgavkaptgghpvvqlhgymenkplglqi figtaderilkphafyqvhritgktvtttsyekivgntkvleiplepknnmratidcagi lklrnadielrkgetdigrkntrvrlvfrvhipessgrivslqtasnpiecsq
Timeline for d1pzum2: