Class b: All beta proteins [48724] (149 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (18 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (6 proteins) subgroup of the larger IPT/TIG domain family |
Protein T-cell transcription factor NFAT1 (NFATC2) [49246] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49247] (4 PDB entries) |
Domain d1pzum1: 1pzu M:576-678 [95481] Other proteins in same PDB: d1pzub2, d1pzud2, d1pzuh2, d1pzui2, d1pzul2, d1pzum2 |
PDB Entry: 1pzu (more details), 3.1 Å
SCOP Domain Sequences for d1pzum1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pzum1 b.1.18.1 (M:576-678) T-cell transcription factor NFAT1 (NFATC2) {Human (Homo sapiens)} elpmverqdtdsclvyggqqmiltgqnftseskvvftekttdgqqiwemeatvdkdksqp nmlfveipeyrnkhirtpvkvnfyvingkrkrsqpqhftyhpv
Timeline for d1pzum1: