Lineage for d1pzui1 (1pzu I:576-678)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 551984Superfamily b.1.18: E set domains [81296] (18 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 551985Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (6 proteins)
    subgroup of the larger IPT/TIG domain family
  6. 552049Protein T-cell transcription factor NFAT1 (NFATC2) [49246] (1 species)
  7. 552050Species Human (Homo sapiens) [TaxId:9606] [49247] (4 PDB entries)
  8. 552063Domain d1pzui1: 1pzu I:576-678 [95477]
    Other proteins in same PDB: d1pzub2, d1pzud2, d1pzuh2, d1pzui2, d1pzul2, d1pzum2

Details for d1pzui1

PDB Entry: 1pzu (more details), 3.1 Å

PDB Description: An asymmetric NFAT1-RHR homodimer on a pseudo-palindromic, Kappa-B site

SCOP Domain Sequences for d1pzui1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pzui1 b.1.18.1 (I:576-678) T-cell transcription factor NFAT1 (NFATC2) {Human (Homo sapiens)}
elpmverqdtdsclvyggqqmiltgqnftseskvvftekttdgqqiwemeatvdkdksqp
nmlfveipeyrnkhirtpvkvnfyvingkrkrsqpqhftyhpv

SCOP Domain Coordinates for d1pzui1:

Click to download the PDB-style file with coordinates for d1pzui1.
(The format of our PDB-style files is described here.)

Timeline for d1pzui1: