SCOP 1.69: Domain d1pzuh2: 1pzu H:399-571

Lineage for d1pzuh2 (1pzu H:399-571)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (7 families)

5. Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (6 proteins)

6. Protein T-cell transcription factor NFAT1 (NFATC), DNA-binding domain [49421] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49422] (6 PDB entries)

8. Domain d1pzuh2: 1pzu H:399-571 [95476]
   Other proteins in same PDB: d1pzub1, d1pzud1, d1pzuh1, d1pzui1, d1pzul1, d1pzum1

Details for d1pzuh2

PDB Entry: 1pzu, 3.1 Å

PDB Description: An asymmetric NFAT1-RHR homodimer on a pseudo-palindromic, Kappa-B site

SCOP Domain Sequences for d1pzuh2:

Sequence; same for both SEQRES and ATOM records:

>d1pzuh2 b.2.5.3 (H:399-571) T-cell transcription factor NFAT1 (NFATC), DNA-binding domain {Human (Homo sapiens)}
wplssqsgsyelrievqpkphhrahyetegsrgavkaptgghpvvqlhgymenkplglqi
figtaderilkphafyqvhritgktvtttsyekivgntkvleiplepknnmratidcagi
lklrnadielrkgetdigrkntrvrlvfrvhipessgrivslqtasnpiecsq

Timeline for d1pzuh2:

• d1pzuh2 first appeared in SCOP 1.67
  
• d1pzuh2 appears in SCOP 1.71
  
• d1pzuh2 appears in the current release, SCOPe 2.08