Lineage for d1pzud1 (1pzu D:576-678)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 658571Superfamily b.1.18: E set domains [81296] (20 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 658572Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (7 proteins)
    subgroup of the larger IPT/TIG domain family
  6. 658646Protein T-cell transcription factor NFAT1 (NFATC2) [49246] (1 species)
  7. 658647Species Human (Homo sapiens) [TaxId:9606] [49247] (7 PDB entries)
  8. 658664Domain d1pzud1: 1pzu D:576-678 [95473]
    Other proteins in same PDB: d1pzub2, d1pzud2, d1pzuh2, d1pzui2, d1pzul2, d1pzum2

Details for d1pzud1

PDB Entry: 1pzu (more details), 3.1 Å

PDB Description: An asymmetric NFAT1-RHR homodimer on a pseudo-palindromic, Kappa-B site
PDB Compounds: (D:) Nuclear factor of activated T-cells, cytoplasmic 2

SCOP Domain Sequences for d1pzud1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pzud1 b.1.18.1 (D:576-678) T-cell transcription factor NFAT1 (NFATC2) {Human (Homo sapiens) [TaxId: 9606]}
elpmverqdtdsclvyggqqmiltgqnftseskvvftekttdgqqiwemeatvdkdksqp
nmlfveipeyrnkhirtpvkvnfyvingkrkrsqpqhftyhpv

SCOP Domain Coordinates for d1pzud1:

Click to download the PDB-style file with coordinates for d1pzud1.
(The format of our PDB-style files is described here.)

Timeline for d1pzud1: