SCOPe 2.08: Domain d1pzqb1: 1pzq B:3-60

Lineage for d1pzqb1 (1pzq B:3-60)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.34: Dimerisation interlock [47405] (4 superfamilies)
   4 helices; bundle, closed, right-handed twist

4. Superfamily a.34.3: Docking domain A of the erythromycin polyketide synthase (DEBS) [101166] (1 family)
   automatically mapped to Pfam PF09277

5. Family a.34.3.1: Docking domain A of the erythromycin polyketide synthase (DEBS) [101167] (1 protein)

6. Protein Erythronolide synthase [101168] (1 species)

7. Species Saccharopolyspora erythraea [TaxId:1836] [101169] (1 PDB entry)

8. Domain d1pzqb1: 1pzq B:3-60 [95467]
   Other proteins in same PDB: d1pzqa2, d1pzqb2
   fused interacting segments

Details for d1pzqb1

PDB Entry: 1pzq

PDB Description: structure of fused docking domains from the erythromycin polyketide synthase (debs), a model for the interaction between debs 2 and debs 3: the a domain

PDB Compounds: (B:) erythronolide synthase

SCOPe Domain Sequences for d1pzqb1:

Sequence; same for both SEQRES and ATOM records:

>d1pzqb1 a.34.3.1 (B:3-60) Erythronolide synthase {Saccharopolyspora erythraea [TaxId: 1836]}
aaspavdigdrldelekalealsaedghddvgqrlesllrrwnsrradapstsaised

Timeline for d1pzqb1:

• d1pzqb1 first appeared in SCOP 1.67, called d1pzqb_
  
• d1pzqb1 appears in SCOPe 2.07