Lineage for d1pzqb1 (1pzq B:3-60)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709270Fold a.34: Dimerisation interlock [47405] (4 superfamilies)
    4 helices; bundle, closed, right-handed twist
  4. 2709303Superfamily a.34.3: Docking domain A of the erythromycin polyketide synthase (DEBS) [101166] (1 family) (S)
    automatically mapped to Pfam PF09277
  5. 2709304Family a.34.3.1: Docking domain A of the erythromycin polyketide synthase (DEBS) [101167] (1 protein)
  6. 2709305Protein Erythronolide synthase [101168] (1 species)
  7. 2709306Species Saccharopolyspora erythraea [TaxId:1836] [101169] (1 PDB entry)
  8. 2709308Domain d1pzqb1: 1pzq B:3-60 [95467]
    Other proteins in same PDB: d1pzqa2, d1pzqb2
    fused interacting segments

Details for d1pzqb1

PDB Entry: 1pzq (more details)

PDB Description: structure of fused docking domains from the erythromycin polyketide synthase (debs), a model for the interaction between debs 2 and debs 3: the a domain
PDB Compounds: (B:) erythronolide synthase

SCOPe Domain Sequences for d1pzqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pzqb1 a.34.3.1 (B:3-60) Erythronolide synthase {Saccharopolyspora erythraea [TaxId: 1836]}
aaspavdigdrldelekalealsaedghddvgqrlesllrrwnsrradapstsaised

SCOPe Domain Coordinates for d1pzqb1:

Click to download the PDB-style file with coordinates for d1pzqb1.
(The format of our PDB-style files is described here.)

Timeline for d1pzqb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pzqb2