Class a: All alpha proteins [46456] (289 folds) |
Fold a.34: Dimerisation interlock [47405] (4 superfamilies) 4 helices; bundle, closed, right-handed twist |
Superfamily a.34.3: Docking domain A of the erythromycin polyketide synthase (DEBS) [101166] (1 family) automatically mapped to Pfam PF09277 |
Family a.34.3.1: Docking domain A of the erythromycin polyketide synthase (DEBS) [101167] (1 protein) |
Protein Erythronolide synthase [101168] (1 species) |
Species Saccharopolyspora erythraea [TaxId:1836] [101169] (1 PDB entry) |
Domain d1pzqa1: 1pzq A:3-60 [95466] Other proteins in same PDB: d1pzqa2, d1pzqb2 fused interacting segments |
PDB Entry: 1pzq (more details)
SCOPe Domain Sequences for d1pzqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pzqa1 a.34.3.1 (A:3-60) Erythronolide synthase {Saccharopolyspora erythraea [TaxId: 1836]} aaspavdigdrldelekalealsaedghddvgqrlesllrrwnsrradapstsaised
Timeline for d1pzqa1: