SCOPe 2.06: Domain d1pzqa1: 1pzq A:3-60

Lineage for d1pzqa1 (1pzq A:3-60)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.34: Dimerisation interlock [47405] (4 superfamilies)
   4 helices; bundle, closed, right-handed twist

4. Superfamily a.34.3: Docking domain A of the erythromycin polyketide synthase (DEBS) [101166] (1 family)
   automatically mapped to Pfam PF09277

5. Family a.34.3.1: Docking domain A of the erythromycin polyketide synthase (DEBS) [101167] (1 protein)

6. Protein Erythronolide synthase [101168] (1 species)

7. Species Saccharopolyspora erythraea [TaxId:1836] [101169] (1 PDB entry)

8. Domain d1pzqa1: 1pzq A:3-60 [95466]
   Other proteins in same PDB: d1pzqa2, d1pzqb2
   fused interacting segments

Details for d1pzqa1

PDB Entry: 1pzq

PDB Description: structure of fused docking domains from the erythromycin polyketide synthase (debs), a model for the interaction between debs 2 and debs 3: the a domain

PDB Compounds: (A:) erythronolide synthase

SCOPe Domain Sequences for d1pzqa1:

Sequence; same for both SEQRES and ATOM records:

>d1pzqa1 a.34.3.1 (A:3-60) Erythronolide synthase {Saccharopolyspora erythraea [TaxId: 1836]}
aaspavdigdrldelekalealsaedghddvgqrlesllrrwnsrradapstsaised

Timeline for d1pzqa1:

• d1pzqa1 first appeared in SCOP 1.67, called d1pzqa_
  
• d1pzqa1 was called d1pzqa_ in SCOPe 2.05
  
• d1pzqa1 appears in SCOPe 2.07
  
• d1pzqa1 appears in the current release, SCOPe 2.08