Lineage for d1pzng1 (1pzn G:96-349)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2112131Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (21 protein domains)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 2112413Protein DNA repair protein Rad51, catalytic domain [82412] (7 species)
  7. 2112457Species Pyrococcus furiosus [TaxId:2261] [102377] (1 PDB entry)
  8. 2112464Domain d1pzng1: 1pzn G:96-349 [95463]
    Other proteins in same PDB: d1pzna1
    complexed with gol, imd, mpd, so4

Details for d1pzng1

PDB Entry: 1pzn (more details), 2.85 Å

PDB Description: Rad51 (RadA)
PDB Compounds: (G:) DNA repair and recombination protein rad51

SCOPe Domain Sequences for d1pzng1:

Sequence, based on SEQRES records: (download)

>d1pzng1 c.37.1.11 (G:96-349) DNA repair protein Rad51, catalytic domain {Pyrococcus furiosus [TaxId: 2261]}
tfmradeylkkratigristgsksldkllgggietqaitevfgefgsgktqlahtlavmv
qlppeegglngsviwidtentfrperireiaqnrgldpdevlkhiyvarafnsnhqmllv
qqaedkikellntdrpvkllivdsltshfrseyigrgalaerqqklakhladlhrlanly
diavfvtnqvqarpdaffgdptrpigghilahsatlrvylrkgkggkriarlidaphlpe
geavfsitekgied

Sequence, based on observed residues (ATOM records): (download)

>d1pzng1 c.37.1.11 (G:96-349) DNA repair protein Rad51, catalytic domain {Pyrococcus furiosus [TaxId: 2261]}
tfmradeylkkratigristgsksldkllgggietqaitevfgefgsgktqlahtlavmv
qlppeegglngsviwidtentfrperireiaqnrgldpdevlkhiyvarafnsnhqmllv
qqaedkikellntdrpvkllivdsltshfrseyigrgalaerqqklakhladlhrlanly
diavfvtnqvqhilahsatlrvylrkgkggkriarlidaphlpegeavfsitekgied

SCOPe Domain Coordinates for d1pzng1:

Click to download the PDB-style file with coordinates for d1pzng1.
(The format of our PDB-style files is described here.)

Timeline for d1pzng1: