Lineage for d1pzne1 (1pzn E:96-349)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 483669Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 483670Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 484903Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (14 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 485060Protein DNA repair protein Rad51, catalytic domain [82412] (4 species)
  7. 485063Species Archaeon Pyrococcus furiosus [TaxId:2261] [102377] (1 PDB entry)
  8. 485068Domain d1pzne1: 1pzn E:96-349 [95461]
    Other proteins in same PDB: d1pzna1

Details for d1pzne1

PDB Entry: 1pzn (more details), 2.85 Å

PDB Description: Rad51 (RadA)

SCOP Domain Sequences for d1pzne1:

Sequence, based on SEQRES records: (download)

>d1pzne1 c.37.1.11 (E:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus}
tfmradeylkkratigristgsksldkllgggietqaitevfgefgsgktqlahtlavmv
qlppeegglngsviwidtentfrperireiaqnrgldpdevlkhiyvarafnsnhqmllv
qqaedkikellntdrpvkllivdsltshfrseyigrgalaerqqklakhladlhrlanly
diavfvtnqvqarpdaffgdptrpigghilahsatlrvylrkgkggkriarlidaphlpe
geavfsitekgied

Sequence, based on observed residues (ATOM records): (download)

>d1pzne1 c.37.1.11 (E:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus}
tfmradeylkkratigristgsksldkllgggietqaitevfgefgsgktqlahtlavmv
qlppeegglngsviwidtentfrperireiaqnrgldpdevlkhiyvarafnsnhqmllv
qqaedkikellntdrpvkllivdsltshfrseyigrgalaerqqklakhladlhrlanly
diavfvtnqvqghilahsatlrvylrkgkggkriarlidaphlpegeavfsitekgied

SCOP Domain Coordinates for d1pzne1:

Click to download the PDB-style file with coordinates for d1pzne1.
(The format of our PDB-style files is described here.)

Timeline for d1pzne1: